XPO1 anticorps

N° du produit ABIN633311

L’anticorps Lapin Polyclonal anti-XPO1 a été validé pour WB. Il convient pour détecter XPO1 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour XPO1 anticorps (ABIN633311)

Antigène: XPO1 (Exportin 1 (XPO1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp XPO1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-XPO1 anticorps

Purification: Affinity purified

Immunogène: XPO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSH

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

XPO1 Blocking Peptide, (ABIN5617042), is also available for use as a blocking control in assays to test for specificity of this XPO1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XPO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur XPO1

Antigène: XPO1 (Exportin 1 (XPO1))

Autre désignation: XPO1

Sujet: XPO1 mediates leucine-rich nuclear export signal (NES)-dependent protein transport. Exportin 1 specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. XPO1 also regulates NFAT and AP-1.

Poids moléculaire: 123 kDa (MW of target protein)

Pathways: M Phase